Protein Info for DZA65_RS20550 in Dickeya dianthicola ME23

Annotation: sulfurtransferase complex subunit TusC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 28 to 45 (18 residues), see Phobius details PF02635: DsrE" amino acids 2 to 119 (118 residues), 100.8 bits, see alignment E=2.6e-33 TIGR03010: sulfur relay protein TusC/DsrF" amino acids 4 to 119 (116 residues), 162 bits, see alignment E=2.5e-52

Best Hits

Swiss-Prot: 72% identical to TUSC_PECCP: Protein TusC (tusC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K07236, tRNA 2-thiouridine synthesizing protein C (inferred from 92% identity to ddd:Dda3937_00522)

MetaCyc: 69% identical to sulfurtransferase complex subunit TusC (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusC"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CUE7 at UniProt or InterPro

Protein Sequence (119 amino acids)

>DZA65_RS20550 sulfurtransferase complex subunit TusC (Dickeya dianthicola ME23)
MKRVAFVFTQAPHGSAVGREGLDALLAMSALTEDIGVFFIADGVFQLLPNQRPDLILMRD
YIATFGVLPLYDIERCYVCEASLRQRGLPSQTRWVLDVEPLAADALRATLNTYDTVLTF