Protein Info for DZA65_RS20525 in Dickeya dianthicola ME23

Annotation: elongation factor Tu

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR00485: translation elongation factor Tu" amino acids 1 to 393 (393 residues), 792 bits, see alignment E=8e-243 PF00009: GTP_EFTU" amino acids 10 to 201 (192 residues), 219.8 bits, see alignment E=3.6e-69 TIGR00231: small GTP-binding protein domain" amino acids 13 to 148 (136 residues), 52 bits, see alignment E=6.9e-18 PF03144: GTP_EFTU_D2" amino acids 225 to 294 (70 residues), 68.5 bits, see alignment E=8.4e-23 PF03143: GTP_EFTU_D3" amino acids 298 to 392 (95 residues), 135.1 bits, see alignment E=1.7e-43

Best Hits

Swiss-Prot: 98% identical to EFTU_SODGM: Elongation factor Tu (tuf1) from Sodalis glossinidius (strain morsitans)

KEGG orthology group: K02358, elongation factor Tu (inferred from 100% identity to dze:Dd1591_3892)

Predicted SEED Role

"Translation elongation factor Tu" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>DZA65_RS20525 elongation factor Tu (Dickeya dianthicola ME23)
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGQARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIA