Protein Info for DZA65_RS20515 in Dickeya dianthicola ME23

Annotation: bacterioferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR00754: bacterioferritin" amino acids 1 to 157 (157 residues), 270.5 bits, see alignment E=2.2e-85 PF00210: Ferritin" amino acids 9 to 143 (135 residues), 132.9 bits, see alignment E=4.3e-43

Best Hits

Swiss-Prot: 87% identical to BFR_SERMA: Bacterioferritin (bfr) from Serratia marcescens

KEGG orthology group: K03594, bacterioferritin (inferred from 95% identity to ddc:Dd586_3738)

MetaCyc: 84% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]

Predicted SEED Role

"Bacterioferritin" in subsystem Iron acquisition in Vibrio

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2Z8 at UniProt or InterPro

Protein Sequence (157 amino acids)

>DZA65_RS20515 bacterioferritin (Dickeya dianthicola ME23)
MKGDKNVITHLNKLLGNELVAINQYFLHARMFKNWGLKRLNDHEYHESIDEMKHADRYIE
RILFLEGIPNLQDLGKLNIGEDVEEMLRSDLALELEGARDLREAIAYADSVRDYVSRDLM
VDVLADEEEHIDWLETELELITRLGIQNYLQTQLKEE