Protein Info for DZA65_RS20380 in Dickeya dianthicola ME23

Annotation: DNA-directed RNA polymerase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR02027: DNA-directed RNA polymerase, alpha subunit" amino acids 24 to 316 (293 residues), 375.6 bits, see alignment E=8.3e-117 PF01193: RNA_pol_L" amino acids 29 to 228 (200 residues), 88.7 bits, see alignment E=2.4e-29 PF01000: RNA_pol_A_bac" amino acids 59 to 178 (120 residues), 121.3 bits, see alignment E=4.1e-39 PF03118: RNA_pol_A_CTD" amino acids 244 to 308 (65 residues), 84.1 bits, see alignment E=6.6e-28

Best Hits

Swiss-Prot: 100% identical to RPOA_YERP3: DNA-directed RNA polymerase subunit alpha (rpoA) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K03040, DNA-directed RNA polymerase subunit alpha [EC: 2.7.7.6] (inferred from 99% identity to eay:EAM_3173)

MetaCyc: 99% identical to RNA polymerase subunit alpha (Escherichia coli K-12 substr. MG1655)
DNA-directed RNA polymerase. [EC: 2.7.7.6]

Predicted SEED Role

"DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSS2 at UniProt or InterPro

Protein Sequence (329 amino acids)

>DZA65_RS20380 DNA-directed RNA polymerase subunit alpha (Dickeya dianthicola ME23)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASINMRIKVQRGRGYVPASARIHTEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE