Protein Info for DZA65_RS20355 in Dickeya dianthicola ME23

Annotation: Trk system potassium transporter TrkA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF03807: F420_oxidored" amino acids 2 to 49 (48 residues), 21.9 bits, see alignment 1.4e-07 PF01262: AlaDh_PNT_C" amino acids 2 to 71 (70 residues), 23.8 bits, see alignment E=1.7e-08 PF02254: TrkA_N" amino acids 3 to 125 (123 residues), 101.6 bits, see alignment E=2.1e-32 amino acids 235 to 350 (116 residues), 87.2 bits, see alignment E=6.1e-28 PF02080: TrkA_C" amino acids 158 to 224 (67 residues), 43.9 bits, see alignment E=1.1e-14 amino acids 391 to 450 (60 residues), 38.2 bits, see alignment E=6.8e-13 PF13241: NAD_binding_7" amino acids 233 to 319 (87 residues), 22.4 bits, see alignment E=9.4e-08

Best Hits

Swiss-Prot: 85% identical to TRKA_SALTI: Trk system potassium uptake protein TrkA (trkA) from Salmonella typhi

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 99% identity to ddc:Dd586_3706)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CDB4 at UniProt or InterPro

Protein Sequence (458 amino acids)

>DZA65_RS20355 Trk system potassium transporter TrkA (Dickeya dianthicola ME23)
MKIIILGAGQVGGTLAENLSGENNDITVVDTNTTRLRQLQDKFDLRVVTGYASHPRVLRE
AGAEDADMLIAVTNSDETNMIACQVAYSLFNTPNRIARIRASEYIRESEQLFQAEAVPID
HLISPEQLVIDNIYKLIEYPGALQVVNFAEGKVSIAAVNAYYGGPLVGNAIATMRDHMPH
IETRVAAIFRHDRPIRPQGSTVIEAGDEVFFIAASQHIRAVMSEMQRLEKPYKRIMIVGG
GNVGAGLALKLEKDYSVKLIERDALRAAELAERLQHTIVFHGDASDQELLAQEHVEQIDV
FIAITNDDEANIMSAMLAKRMGAKKAMVLIQRRAYVDLVQGSVIDVAISPQQATISALLG
HVRKADIVSVSSLRRGVAEAIEAIAHGDEGTSKVVGRMIADIKLPPGTIIGAIVRGDDVI
IANNNLQIEQGDHVIMFLTDKKYVSDVERLFQPSPFFL