Protein Info for DZA65_RS20320 in Dickeya dianthicola ME23

Annotation: L-threonylcarbamoyladenylate synthase type 1 TsaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01300: Sua5_yciO_yrdC
  • amino acids 15 to 189 (175 residues), 166.5 bits, E=2.3e-53

Best Hits

Swiss-Prot: 71% identical to TSAC_YERE8: Threonylcarbamoyl-AMP synthase (tsaC) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K07566, putative translation factor (inferred from 95% identity to ddd:Dda3937_01527)

MetaCyc: 69% identical to L-threonylcarbamoyladenylate synthase (Escherichia coli K-12 substr. MG1655)
RXN-14569 [EC: 2.7.7.87]

Predicted SEED Role

"TsaC protein (YrdC domain) required for threonylcarbamoyladenosine t(6)A37 modification in tRNA"

MetaCyc Pathways

• N⁶-L-threonylcarbamoyladenosine³⁷-modified tRNA biosynthesis (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.87

Sequence Analysis Tools

See A0A385Y4C8 at UniProt or InterPro

Protein Sequence (189 amino acids)

>DZA65_RS20320 L-threonylcarbamoyladenylate synthase type 1 TsaC (Dickeya dianthicola ME23)
MSNVNSEDLAPLLQQLREDNVIAYPTEAVFGLGCDPDSETAVERLLALKQRPREKGLILI
AADFQQLEPYVEMSALSDMQRQTIFASWPGPVTWVLPAKTVTPDWLTGRFTSLAVRVSAH
PLVKQLCLAFGKPLVSTSANLSGQPPCRTVREVAKQFGERFPVLNGEVGGRLNPSEIRDA
LTGEMLRQG