Protein Info for DZA65_RS20255 in Dickeya dianthicola ME23

Annotation: glyoxylate bypass operon transcriptional repressor IclR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF09339: HTH_IclR" amino acids 29 to 79 (51 residues), 66.6 bits, see alignment 2e-22 PF01614: IclR_C" amino acids 98 to 269 (172 residues), 161 bits, see alignment E=3.3e-51

Best Hits

Swiss-Prot: 76% identical to ICLR_SALTY: Acetate operon repressor (iclR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K13641, IclR family transcriptional regulator, acetate operon repressor (inferred from 98% identity to ddd:Dda3937_02130)

Predicted SEED Role

"Acetate operon repressor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0M3 at UniProt or InterPro

Protein Sequence (276 amino acids)

>DZA65_RS20255 glyoxylate bypass operon transcriptional repressor IclR (Dickeya dianthicola ME23)
MTPPEPAKRGKKPRAAAASPAQPAGQVQSLTRGLTLLEYIAKANGSIALTDLAQQAGLPN
STTHRLLTTMQQQGFVRQVGDLGLWTIGTHAFIVGSSFLQSRNLLSLVHPMLRQLMESSG
ETVNLAVLDQSDYQAVIIDQVQCTALMRMSAPIGGKLPMHASGAGKAFLAMLPDDKITQL
LHRKGLHSYTPHTLSAQTLKENLTSIRRQGYALDDEEHALGLRCVAACILDEHHDAFAAI
SISGPVSRITDDRITELGALVIKAAKEITYQYGGAR