Protein Info for DZA65_RS20160 in Dickeya dianthicola ME23

Annotation: phosphatidylserine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF27523: PSD" amino acids 5 to 46 (42 residues), 50 bits, see alignment 1.9e-17 TIGR00163: phosphatidylserine decarboxylase" amino acids 49 to 283 (235 residues), 295.3 bits, see alignment E=1.4e-92 PF02666: PS_Dcarbxylase" amino acids 63 to 283 (221 residues), 193.5 bits, see alignment E=3.4e-61

Best Hits

Swiss-Prot: 96% identical to PSD_DICD3: Phosphatidylserine decarboxylase proenzyme (psd) from Dickeya dadantii (strain 3937)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 96% identity to ddd:Dda3937_02150)

MetaCyc: 73% identical to phosphatidylserine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.65

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CHH4 at UniProt or InterPro

Protein Sequence (304 amino acids)

>DZA65_RS20160 phosphatidylserine decarboxylase (Dickeya dianthicola ME23)
MLDRIKIALQHLLPKVWLTQLAGWGAGRQAGLLTKLVIDLFARIYKVNMQEAQQTDTASY
RSFNDFFVRPLKPGIRPVDPLANRLVFPADGAISQLGTIDDLQILQAKQHNYSLEALLAG
NVIIADLFRDGLFVTTYLSPRDYHRVHMPCDGILRDMIYVPGDLFSVNPLTAANVPNLFA
RNERVICLFDTPFGPMVQILVGATIVGSIETVWAGVVTPPREGIIKRWAYPMEGEGAVIL
EKGDEMGRFKLGSTVINLFAKDRVQLMPGLASQSVTRMGEAMAEALDEDIQTRMSANDDT
DTTP