Protein Info for DZA65_RS20135 in Dickeya dianthicola ME23

Annotation: proline/glycine betaine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 272 (167 residues), 85.6 bits, see alignment E=1.8e-28

Best Hits

Swiss-Prot: 49% identical to OPUAB_BACSU: Glycine betaine transport system permease protein OpuAB (opuAB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 61% identity to bgf:BC1003_5859)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CVE5 at UniProt or InterPro

Protein Sequence (278 amino acids)

>DZA65_RS20135 proline/glycine betaine ABC transporter permease (Dickeya dianthicola ME23)
MSYPLDFSRQIDAAIHAMLAHDGGFFDGVARVIDGFAGGLEELVGALSPWGLVIIAVGLG
AWRIGKGFALFTLLATLYIIYSGYSDHAAVTLALTLSSTFFSLLIGIPLGIWSARRATVG
SIVRTLLDFMQTMPAFVYLIPATILFGLGRPPGIFATILFSMPPVVRLTDLGIRQVNVAR
LEAGIAFGCTPWQLLWKVQLPAAQPSIMAGINQTIMMAMSMVIIASMVGAGGLGNDILSS
IQQLEIGLGLQSGLVVVLMAILLDRLSASFAHRRHQQR