Protein Info for DZA65_RS20085 in Dickeya dianthicola ME23

Annotation: thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 70 to 87 (18 residues), see Phobius details PF00975: Thioesterase" amino acids 8 to 231 (224 residues), 71 bits, see alignment E=3.6e-23 PF12146: Hydrolase_4" amino acids 8 to 193 (186 residues), 27.8 bits, see alignment E=3.1e-10 PF12697: Abhydrolase_6" amino acids 9 to 199 (191 residues), 47.5 bits, see alignment E=7.5e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3I0 at UniProt or InterPro

Protein Sequence (237 amino acids)

>DZA65_RS20085 thioesterase (Dickeya dianthicola ME23)
MNELPSHMVLFHHAGGNASSMQAIARRFSSAFSTMLMEMPGRGRRRQEALMYDVGAIVDD
FAARIPEQGRLILVGHSLGAYIAYLLARHCRRITPERDIVLVVMSNDPIHCRRRFPWREL
NPESQQAIWHFATRLGELPDWLTQDDVLRQQFIQVLAADLAVANSIRAEDTEPLNGVPVL
VIYGDDDPHLPDAPARWGECTSGIYRMESVPGGHFIQSGSDVGDIIFRFISDVDMEK