Protein Info for DZA65_RS20030 in Dickeya dianthicola ME23

Annotation: nitrogenase iron protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF00142: Fer4_NifH" amino acids 4 to 275 (272 residues), 436.8 bits, see alignment E=1e-134 TIGR01287: nitrogenase iron protein" amino acids 4 to 278 (275 residues), 479.1 bits, see alignment E=2e-148 PF02374: ArsA_ATPase" amino acids 4 to 46 (43 residues), 26.3 bits, see alignment 1.3e-09 PF01656: CbiA" amino acids 8 to 228 (221 residues), 49.7 bits, see alignment E=1.1e-16 PF10609: ParA" amino acids 9 to 57 (49 residues), 29.7 bits, see alignment 1.3e-10 PF13614: AAA_31" amino acids 10 to 70 (61 residues), 40.3 bits, see alignment E=9.9e-14

Best Hits

Swiss-Prot: 97% identical to NIFH_KLEP3: Nitrogenase iron protein (nifH) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02588, nitrogenase iron protein NifH [EC: 1.18.6.1] (inferred from 98% identity to dda:Dd703_0491)

MetaCyc: 96% identical to [FeMo]-nitrogenase complex nitrogenase reductase component monomer (Klebsiella pneumoniae)

Predicted SEED Role

"Nitrogenase (molybdenum-iron) reductase and maturation protein NifH" in subsystem Nitrogen fixation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C8B2 at UniProt or InterPro

Protein Sequence (293 amino acids)

>DZA65_RS20030 nitrogenase iron protein (Dickeya dianthicola ME23)
MAMRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADSTRLILHAKAQNTIME
MAAEVGSVEDLELEDVLQIGYGDVRCAESGGPEPGVGCAGRGVITAINFLEEEGAYEEDI
DFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAANNISKGIVKYAKSGKVRL
GGLICNSRQTDREDELIIALAEKLGTQMIHFVPRDNIVQRAEIRRMTVIEYDPTCNQADE
YRTLAGKIVNNTKMVVPTPVTMDELEALLMEFGIMEEEDTSIIGKTAAEENAA