Protein Info for DZA65_RS19985 in Dickeya dianthicola ME23

Annotation: nitrogenase iron-molybdenum cofactor biosynthesis protein NifE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR01283: nitrogenase MoFe cofactor biosynthesis protein NifE" amino acids 4 to 456 (453 residues), 684.7 bits, see alignment E=2.6e-210 PF00148: Oxidored_nitro" amino acids 37 to 441 (405 residues), 322.6 bits, see alignment E=1.7e-100

Best Hits

Swiss-Prot: 86% identical to NIFE_KLEPN: Nitrogenase iron-molybdenum cofactor biosynthesis protein NifE (nifE) from Klebsiella pneumoniae

KEGG orthology group: K02587, nitrogenase molybdenum-cofactor synthesis protein NifE (inferred from 97% identity to ddd:Dda3937_02164)

MetaCyc: 66% identical to Nitrogenase iron-molybdenum cofactor biosynthesis protein NifE (Azotobacter vinelandii)
RXN-17026

Predicted SEED Role

"Nitrogenase FeMo-cofactor scaffold and assembly protein NifE" in subsystem Nitrogen fixation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3G0 at UniProt or InterPro

Protein Sequence (457 amino acids)

>DZA65_RS19985 nitrogenase iron-molybdenum cofactor biosynthesis protein NifE (Dickeya dianthicola ME23)
MKGSEILALFDEPACEHNHKQKSGCSAPKPGATAGGCAFDGAQITLLPLADVAHLVHGPI
GCTGSSWDNRGSRSSGPTLNRLGFTTDLNEQDVIMGRGERRLFHAVRHIVSRYHPTAVFI
YNTCVPAMEGDDIDAVCRAASAAVGVPVVAIDAAGFYGSKNFGNRLAGEVMVKQVIGQRE
PAPWPQDTPFAPEHRHDVGLIGEFNIAGEFWNVLPLLDELGIRVLGSLSGDARFAEIQTL
HRAEANMLVCSRALINVARQLEQRYGIPWFEGSFYGVRAMSDALRQLAAMTGDTDLMTRT
ETLIAREEAATAQALAPYRERLQGRKVLLYTGGVKSWSVVSALQDLGVTVVATGTRKSTE
EDKQRIRELMGDDALMLEEGNARTLLDVVYRYGADMMIAGGRNMYTAYKARLPFLDINQE
REHAFAGYRGLVALAQQLCLTLDSPIWRQTHQRAPWH