Protein Info for DZA65_RS19970 in Dickeya dianthicola ME23

Annotation: Fe-S cluster assembly protein NifU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR02000: Fe-S cluster assembly protein NifU" amino acids 1 to 281 (281 residues), 468.1 bits, see alignment E=5.7e-145 PF01592: NifU_N" amino acids 4 to 125 (122 residues), 158.4 bits, see alignment E=1.4e-50 PF04324: Fer2_BFD" amino acids 135 to 183 (49 residues), 62.8 bits, see alignment 4.6e-21 PF01106: NifU" amino acids 215 to 278 (64 residues), 64.1 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K13819, NifU-like protein (inferred from 97% identity to ddd:Dda3937_02171)

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein NifU" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C8C1 at UniProt or InterPro

Protein Sequence (281 amino acids)

>DZA65_RS19970 Fe-S cluster assembly protein NifU (Dickeya dianthicola ME23)
MWNYSEKVKDHFFNPRNARVVAEANAVGDVGSLSCGDALRLMLRVDPDSETILDAGFQTF
GCGSAIASSSALTELIIGRTLREAEQVTNQQIADYLDGLPPEKMHCSVMGQEALRVAIAN
YRGETLEDDHEEGALICKCFAVDEGQIRRAVVANGLTTLQEVIHYTKAGGGCSACHEKIE
LALAQILSEHEAMPAAAAIPAVTEIVVKDARWQQVAEAVAELRPHIQADGGDMSLVNVSE
RQVTVSLSGSCSGCMMTDMTLAWLQQKLVERTGQYMDVVAA