Protein Info for DZA65_RS19965 in Dickeya dianthicola ME23

Annotation: cysteine desulfurase NifS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 78% identical to NIFS_ENTAG: Cysteine desulfurase (nifS) from Enterobacter agglomerans

KEGG orthology group: K04487, cysteine desulfurase [EC: 2.8.1.7] (inferred from 97% identity to ddd:Dda3937_02172)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), NifS subfamily" in subsystem Alanine biosynthesis or Nitrogen fixation (EC 2.8.1.7)

MetaCyc Pathways

superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
superpathway of L-alanine biosynthesis (4/4 steps found)
superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
molybdopterin biosynthesis (5/6 steps found)
L-alanine biosynthesis III (1/1 steps found)
L-cysteine degradation IV (1/1 steps found)
thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
tRNA-uridine 2-thiolation and selenation (bacteria) (7/11 steps found)
bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
[2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)
tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)

KEGG Metabolic Maps

Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D9K6 at UniProt or InterPro

Protein Sequence (420 amino acids)

>DZA65_RS19965 cysteine desulfurase NifS (Dickeya dianthicola ME23)
MNNVYPDKKNSSDKKNGPDKKIYLDNNATTRLDPMVLEAMLPFLTEHYGNPSSIHDFGTP
CRGALERARQQVASLLGARYDSEILFTSCATEATSSAIYSAVNLAPERREIITTAVEHPA
TLEVCEHLARQGYTIHRLAVSPQGALDLAEYRRLLSDRVALVSVMWANNETGVLFPVPEM
AALAHEHGILFHCDAVQAVGKTPMALSATDIDMLSCSAHKIHGPKGVGCLYLRRNTRFRP
LLRGGHQERGRRAGTENIAGIVGMGSACELAEIHLPMMTAAVAPLRDTLQHELARRIPSV
MVMGDGQPRTPNTLNMAFEFIEGEAILLLMNHVGIAASSGSACTSGSLEPSHVMRAMDIP
YTAAHGSIRFSLSRYTREKEIDYVIEQLPPIIARLRTLSPYWQQDKPAALAGAAFAPTYG