Protein Info for DZA65_RS19960 in Dickeya dianthicola ME23

Annotation: homocitrate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF00682: HMGL-like" amino acids 4 to 257 (254 residues), 238.4 bits, see alignment E=9.2e-75 TIGR02660: homocitrate synthase" amino acids 4 to 367 (364 residues), 525.7 bits, see alignment E=3.6e-162 PF22617: HCS_D2" amino acids 275 to 354 (80 residues), 58.9 bits, see alignment E=5.3e-20

Best Hits

Swiss-Prot: 69% identical to NIFV_KLEPN: Homocitrate synthase (nifV) from Klebsiella pneumoniae

KEGG orthology group: K01655, homocitrate synthase [EC: 2.3.3.14] K02594, homocitrate synthase NifV (inferred from 92% identity to ddd:Dda3937_02173)

Predicted SEED Role

"Homocitrate synthase (EC 2.3.3.14)" in subsystem Nitrogen fixation (EC 2.3.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4Y0 at UniProt or InterPro

Protein Sequence (382 amino acids)

>DZA65_RS19960 homocitrate synthase (Dickeya dianthicola ME23)
MDAVIINDTTLRDGEQSPGVAFRASEKLAIAEALAEAGVPALEVGTPAMGAEERSRMALV
RRRLPGMVMMAWCRMNEDEIRQSADLGMDWVDISVPSSDRLRQQKLRQPLSALLPRLTAL
IALARRCGLRVSIGCEDASRASDAALRQLAQTAQAAGAERLRFADTLGVLDPFTTHDRIQ
ALRQCWPGEIEMHAHNDLGLATANTLAAVRAGATHVNTTVLGLGERAGNAALESVAFGLQ
RCLGRASGIRFAQLPALCRQVAEAARRPIDVQQPLVGEQVFTHESGVHVAALLHDRESYQ
GIDPHLMGREFRLVLGKHSGRQAVGGVFARLGYGLDAPQVDALLDAVRLFAENGKRNPQD
NELRQIYQDLFGDDRALRCQGG