Protein Info for DZA65_RS19955 in Dickeya dianthicola ME23

Annotation: nitrogen fixation protein NifW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 PF03206: NifW" amino acids 10 to 78 (69 residues), 29.9 bits, see alignment E=3.2e-11

Best Hits

Swiss-Prot: 61% identical to NIFW_KLEPN: Nitrogenase-stabilizing/protective protein NifW (nifW) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 84% identity to ddd:Dda3937_02174)

Predicted SEED Role

"Nitrogenase-stabilizing/protective protein nifW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2G6 at UniProt or InterPro

Protein Sequence (89 amino acids)

>DZA65_RS19955 nitrogen fixation protein NifW (Dickeya dianthicola ME23)
MEWFYRLPGVQALQGAEAFFAFFDVPYNADQLSRRQVPVLREFHRRLMAAVPLRNALDDA
PDADWQLARRLLAESYQHGVGGGRDDANV