Protein Info for DZA65_RS19900 in Dickeya dianthicola ME23

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00126: HTH_1" amino acids 7 to 66 (60 residues), 74.1 bits, see alignment E=7.1e-25 PF03466: LysR_substrate" amino acids 91 to 297 (207 residues), 137 bits, see alignment E=6e-44

Best Hits

Swiss-Prot: 56% identical to ABGR_ECOLI: HTH-type transcriptional regulator AbgR (abgR) from Escherichia coli (strain K12)

KEGG orthology group: K14057, LysR family transcriptional regulator, regulator of abg operon (inferred from 98% identity to ddd:Dda3937_02185)

Predicted SEED Role

"Regulatory protein (induces abgABT, used to catabolize p-aminobenzoyl-glutamate)" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZL0 at UniProt or InterPro

Protein Sequence (298 amino acids)

>DZA65_RS19900 LysR family transcriptional regulator (Dickeya dianthicola ME23)
MTQNVKLHQLQSFVEVARHGSIRAASRQLNLSQPALTKSIQELEACLGARLFLRHRQGMA
LTDCGEAYFRHASLIMEELRVAREDIQQRLGQASGRVNIGVGASIAHTVMPEVVSRFHRL
YPQVKLRVTEGQLVAMIHELRQGELDFTVNTYSGSSYDNELLYEKLMEKEYCVVVRRDHP
IQRAHSLEDLLDYEWTMPTPRGSYYKQLFDLFATLPVAPRVSVTCETLMSNVSLVAKTDF
ISILSRDVIRDPILGERLRVLELDQPLPNATFYLIQRKDTMLSPMGAQLAKLFRRYCR