Protein Info for DZA65_RS19865 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 256 to 281 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 65 to 180 (116 residues), 48.2 bits, see alignment E=6.4e-17 PF00528: BPD_transp_1" amino acids 90 to 284 (195 residues), 56.6 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 93% identity to dze:Dd1591_0405)

Predicted SEED Role

"Amino acid ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CAQ0 at UniProt or InterPro

Protein Sequence (311 amino acids)

>DZA65_RS19865 amino acid ABC transporter permease (Dickeya dianthicola ME23)
MTQSIPPALHPPDVSATPLRVVPARYPLRIAGALFSLFIFAGIVESVALNSRWEWPVFAS
YFFNPVILEGLGRTLLLTLLGTLFSILAGTGLALARLSSSTLLSTLAWLYIWLFRSLPLI
LVLIILYNFSYLYDALALGIPFTSIEFFRYPTIDVLGPFAVALLGLTLVQSAYTAEIIRG
GILGVDAGQFEAAAALGLPGYRRTWRIILPQALRSILPTGFNEIISLAKGTSVVYVLALP
ELFYTVQVIYNRTQQVIPLLMVATVWYLVITSVLSVLQYFVERYVARGAVRETPTHPLRR
LFQRLTAHRQR