Protein Info for DZA65_RS19720 in Dickeya dianthicola ME23

Annotation: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 2 to 464 (463 residues), 728.3 bits, see alignment E=1.9e-223 PF00483: NTP_transferase" amino acids 4 to 287 (284 residues), 223.1 bits, see alignment E=1.1e-69 PF12804: NTP_transf_3" amino acids 5 to 120 (116 residues), 28.4 bits, see alignment E=4.4e-10 PF22640: ManC_GMP_beta-helix" amino acids 300 to 347 (48 residues), 58.7 bits, see alignment 1.1e-19 PF01050: MannoseP_isomer" amino acids 353 to 464 (112 residues), 154.4 bits, see alignment E=3.4e-49 PF07883: Cupin_2" amino acids 382 to 450 (69 residues), 43 bits, see alignment E=7.3e-15

Best Hits

Swiss-Prot: 71% identical to MANC_KLEPN: Mannose-1-phosphate guanylyltransferase (manC) from Klebsiella pneumoniae

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] (inferred from 98% identity to ddd:Dda3937_00442)

MetaCyc: 60% identical to mannose-1-phosphate guanylyltransferase (Escherichia coli K-12 substr. MG1655)
Mannose-1-phosphate guanylyltransferase. [EC: 2.7.7.13]

Predicted SEED Role

"Mannose-1-phosphate guanylyltransferase (GDP) (EC 2.7.7.22)" in subsystem Alginate metabolism or Mannose Metabolism (EC 2.7.7.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.13 or 2.7.7.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D1Y6 at UniProt or InterPro

Protein Sequence (465 amino acids)

>DZA65_RS19720 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase (Dickeya dianthicola ME23)
MLLPVIMAGGTGSRLWPLSRELYPKQFICLHGQNSMLQETVNRLSGIETRAPVVICNEEH
RFLVAEQLRQINQLSNNIILEPAGRNTAPAIALAALNAIRQGEDPLLLVLAADHIIENKA
SFHSSIKKAIAYAQKGSLVTFGIVPTGPETGYGYIQRGEKLPGDEFSPHKVLRFVEKPSL
KIAEEYLQSGEYYWNSGMFMFRAKRYLQELEKFRPDILKACQLSIDGVSQQGDFINVQTE
HFITCPDESIDYAVMEKTEDAVVVPLDAGWSDVGSWSALWEVNDKDDNGNSLKGDTFLHN
TNNCYINTDDQLVAAIGVDNLVIVNTKDAVLVVQKDQVQDVKRVVEFLKEKCRREYRRHR
ETYWPWGRCDLIVRTDRFNVNRITVKPGESFPLQMHYHRTEHWVILSGTAKVTIQDKSQL
LTENQSTFIPIGAMHKLENPGKIPLEMLEIQSGSYLGDDDFIEIN