Protein Info for DZA65_RS19700 in Dickeya dianthicola ME23

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR00150: tRNA threonylcarbamoyl adenosine modification protein YjeE" amino acids 8 to 139 (132 residues), 172.3 bits, see alignment E=2.2e-55 PF02367: TsaE" amino acids 9 to 129 (121 residues), 136.4 bits, see alignment E=2.8e-44

Best Hits

Swiss-Prot: 70% identical to TSAE_ECO57: tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (tsaE) from Escherichia coli O157:H7

KEGG orthology group: K06925, UPF0079 ATP-binding protein (inferred from 96% identity to ddd:Dda3937_00438)

MetaCyc: 70% identical to N6-L-threonylcarbamoyladenine synthase, TsaE subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaE protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.234

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y5Q6 at UniProt or InterPro

Protein Sequence (160 amino acids)

>DZA65_RS19700 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE (Dickeya dianthicola ME23)
MKMLFLPLPDEAATIALGAALARACECATIIYLLGDLGAGKTTLSRGFLQALGHQGNVKS
PTYTLVEPYALLPRPVYHFDLYRLADPEELEFMGIRDYLSQDALCLIEWPQQGAGFLPQA
DVELHLGYQGAGRQAEINARTPQGEQIVAALAARAEQEAP