Protein Info for DZA65_RS19685 in Dickeya dianthicola ME23

Annotation: tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR00174: tRNA dimethylallyltransferase" amino acids 12 to 299 (288 residues), 377.7 bits, see alignment E=1.7e-117 PF01715: IPPT" amino acids 46 to 288 (243 residues), 298.9 bits, see alignment E=3.3e-93

Best Hits

Swiss-Prot: 83% identical to MIAA_PECCP: tRNA dimethylallyltransferase (miaA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 97% identity to ddd:Dda3937_00435)

MetaCyc: 77% identical to tRNA dimethylallyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6274 [EC: 2.5.1.75]

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZQ1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>DZA65_RS19685 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA (Dickeya dianthicola ME23)
MNEFETAQHPPAIFIMGPTASGKTALAMALREQLPVELISVDSALIYRGMDIGTAKPGPE
ELARAPHRLLDILDPAEAYSAADFRRDALQAMAEITAAGRIPLLVGGTMLYFKALLEGLS
PLPSADAQVRREIEERARTEGWEALHRQLSVIDPVSAARIHPNDPQRLSRALEVFFVSGN
TLTELTKTSGEALPYRVHQFAIAPATRELLHERIALRFRQMLESGFETEARALFARPDLN
PALPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQLAKRQMTWLRGWEEVCWFDSDRP
GEALRKVIQAVSA