Protein Info for DZA65_RS19665 in Dickeya dianthicola ME23

Annotation: protease modulator HflC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01932: HflC protein" amino acids 1 to 322 (322 residues), 451.8 bits, see alignment E=5e-140 PF01145: Band_7" amino acids 22 to 237 (216 residues), 121 bits, see alignment E=2.9e-39

Best Hits

Swiss-Prot: 79% identical to HFLC_ECO57: Modulator of FtsH protease HflC (hflC) from Escherichia coli O157:H7

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 98% identity to ddd:Dda3937_00431)

MetaCyc: 79% identical to regulator of FtsH protease (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D4C6 at UniProt or InterPro

Protein Sequence (331 amino acids)

>DZA65_RS19665 protease modulator HflC (Dickeya dianthicola ME23)
MRKSVLFILVLLLLVVYASLFVVQEGQRGIVMRFGKVLRDNENKPLVYLPGLHVKIPFLE
SVKTLDARIQTMENQADRFITKEQKDLIVDSYIKWRISDFSRYYLATGGGDVSQAEVLLK
RKFSDRLRSEIGRLDVKGIVTDSRGQLMSDVREALNAGTGETTEADNAIASAAARVERET
SSGGQRINPNSMAALGIEVIDVRIKQINLPTEVSDAIYQRMRAEREAVARRHRSQGQEQA
EKIKAAADYEVTRTLAEAERQGRIMRGEGDADAAKLFASAFSQDPAFYGFIRSLRAYENS
FNSTNQDVLVLSPDSDFFRYMKSPEKSLSTR