Protein Info for DZA65_RS19615 in Dickeya dianthicola ME23

Annotation: SprT family zinc-dependent metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF10263: SprT-like" amino acids 19 to 115 (97 residues), 75.3 bits, see alignment E=3.4e-25 PF17283: Zn_ribbon_SprT" amino acids 125 to 163 (39 residues), 31 bits, see alignment 2e-11

Best Hits

Swiss-Prot: 75% identical to SPRT_PECCP: Protein SprT (sprT) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02742, SprT protein (inferred from 93% identity to ddd:Dda3937_00421)

Predicted SEED Role

"Protein sprT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2G8 at UniProt or InterPro

Protein Sequence (170 amino acids)

>DZA65_RS19615 SprT family zinc-dependent metalloprotease (Dickeya dianthicola ME23)
MNTPRLPIALQQAVMRCLREKLQQANTALGCEYPEPVVNYLQRGSTAGSAWLKTWEIRLN
PVLLLENQQAFIDEVVPHELAHLLVYARFGKAPPHGREWRWMMESVLSVPARRTHRFELA
SVQGKTFPYQCACRRHELTLRRHNRVVRGESEYRCRSCGERLRALVTNSV