Protein Info for DZA65_RS19565 in Dickeya dianthicola ME23

Annotation: small-conductance mechanosensitive channel MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 97 to 126 (30 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 16 to 64 (49 residues), 50.5 bits, see alignment 3.2e-17 PF21088: MS_channel_1st" amino acids 72 to 112 (41 residues), 38.8 bits, see alignment 1.4e-13 PF00924: MS_channel_2nd" amino acids 114 to 180 (67 residues), 68.4 bits, see alignment E=9.3e-23 PF21082: MS_channel_3rd" amino acids 187 to 268 (82 residues), 49.2 bits, see alignment E=1.2e-16

Best Hits

Swiss-Prot: 72% identical to MSCS_EDWI9: Small-conductance mechanosensitive channel (mscS) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 96% identity to ddd:Dda3937_00412)

MetaCyc: 70% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Protein involved in stability of MscS mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D2K7 at UniProt or InterPro

Protein Sequence (294 amino acids)

>DZA65_RS19565 small-conductance mechanosensitive channel MscS (Dickeya dianthicola ME23)
MEELNVAESMGRLQSWLVNNQHILLQYAVNIVASLVILCVGMIVARIMSNTMSRLMVARG
IDVTVADFLSALVRYGIIAFTLIAALSRVGVQTTSVIAVLGAAGLAVGLALQGSLSNFAA
GVLLVVFRPFRTGESVDLGGVAGTVTQVQIFSTTLLTADGKVIVVPNGKIIAGNIINSSR
EPDCRTEIIVGVAYDADIDVVKKVLGDIVAADTRIQHDKGVTIRLNEMGASSLNFVVRLW
SANGDAAAVNWDLLESFKRALDEHRIGIPYPQMDVHLHHAASSAQTGSQSAPTL