Protein Info for DZA65_RS19345 in Dickeya dianthicola ME23

Annotation: Co2+/Mg2+ efflux protein ApaG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04379: DUF525" amino acids 18 to 102 (85 residues), 125.2 bits, see alignment E=5.1e-41

Best Hits

Swiss-Prot: 78% identical to APAG_PECAS: Protein ApaG (apaG) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06195, ApaG protein (inferred from 96% identity to ddc:Dd586_3574)

Predicted SEED Role

"ApaG protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D4Q1 at UniProt or InterPro

Protein Sequence (125 amino acids)

>DZA65_RS19345 Co2+/Mg2+ efflux protein ApaG (Dickeya dianthicola ME23)
MMNAPRVCLQVQSFYVEAQSQPEEGRFVFAYTITIRNLGRHDVKLLNRYWIITNGNGKQT
EVQGEGVIGLQPVIQPGSEFQYTSGAILETPMGTMEGHYQMVDHQGETFQVPITVFRLAI
PSLIH