Protein Info for DZA65_RS19310 in Dickeya dianthicola ME23

Annotation: RNA polymerase-associated protein RapA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 981 PF18339: Tudor_1_RapA" amino acids 3 to 53 (51 residues), 85.5 bits, see alignment 7e-28 PF18337: Tudor_RapA" amino acids 55 to 88 (34 residues), 43.4 bits, see alignment (E = 1.1e-14) amino acids 99 to 131 (33 residues), 31.8 bits, see alignment (E = 4.7e-11) PF04851: ResIII" amino acids 167 to 330 (164 residues), 44.3 bits, see alignment E=6.8e-15 PF00176: SNF2-rel_dom" amino acids 184 to 455 (272 residues), 66.8 bits, see alignment E=6.1e-22 PF00270: DEAD" amino acids 185 to 330 (146 residues), 28.4 bits, see alignment E=4.6e-10 PF00271: Helicase_C" amino acids 504 to 614 (111 residues), 68.1 bits, see alignment E=2.7e-22 PF12137: RapA_C" amino acids 618 to 977 (360 residues), 510.1 bits, see alignment E=1.2e-156

Best Hits

Swiss-Prot: 77% identical to RAPA_CROS8: RNA polymerase-associated protein RapA (rapA) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K03580, ATP-dependent helicase HepA [EC: 3.6.4.-] (inferred from 76% identity to cko:CKO_03323)

Predicted SEED Role

"RNA polymerase associated protein RapA (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.-

Use Curated BLAST to search for 3.6.1.- or 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3T1 at UniProt or InterPro

Protein Sequence (981 amino acids)

>DZA65_RS19310 RNA polymerase-associated protein RapA (Dickeya dianthicola ME23)
MPFTLGQRWISDTESDLGLGTVVAMDARMVTLLFPASGENRLYSRNDAPITRVMFNPGDT
ITSHEGWQLRVEDVHDENGLRTYIGQRLDAIGQQLDTIGQQLDTDEPTELREVFLDSKLT
FNKPQDRLFAGQIDRMDRFALRYRAHRHQLEQALQPWGGLRGMRASLIPHQLHIAREVGQ
RHAPRVLLADEVGLGKTIEAGMIIHQQLLAGRAERVLIVVPETLQHQWLVEMLRRFNLLF
SLFDDERYAEARLDSDNPFETEQLIICSLDFVRRNPSRFEQLLDADWDLLVVDEAHHLVW
SEAAPSAGYKAIECLARAIPAVLLLTATPEQLGQESHFARLRLLDPNRFHDYHEFIAEQQ
QYRPVADAVTLLLSGNRINDSERNALGDMLGEQDIEPLLKSIASDSEDSAAARQELITML
MDRHGTSRVLFRNTRQGVKGFPKRELHQIKLPLPTQYQTAIRVSGIMNTRKSAEDCARDM
LYPEQIYQQFEDDNATWWSFDPRVEWMLDFLTSHRDEKVLVICAKAATALQLEQVLRTRE
AIRAAVFHEGLSILERDRAAAYFASEEEGAQVLICSEIGSEGRNFQFASHLIMFDLPFNP
DLLEQRIGRLDRIGQSRDIQILVPYLENTAQALLVRWYHEGLDAFEHTCPTGRSIYDSHY
EQFINLLAKPSEQTGLDEFIHACRQQHDALKTQLEQGRDRLLEMHSNGGEQAQALAEAIA
RQDNDVNLVNFALNLFDIIGIHQDDRSDNLIVLTPSEHMLVPDFPGLPQDGCTITFDRDQ
ALSREDAQFVSWEHPLIRNGLDLILSGDTGSCAVSLLKNKALPVGTLLAELVYVVEAQAP
KKLQLTRFLPPTPIRILLDRKGANLAAQVEFESFNRQLSAVNRHTSSKLVNAVQDDVHDM
LQKAQPLVEAQAQELIADAQRNAETQLRREQERLEALKAVNPNIRDDELEALEEQREQVL
LNLQQANWRLDAIRLVMVAHQ