Protein Info for DZA65_RS19170 in Dickeya dianthicola ME23

Annotation: L-alanine exporter AlaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details PF06610: AlaE" amino acids 5 to 142 (138 residues), 227.3 bits, see alignment E=3.5e-72

Best Hits

Swiss-Prot: 91% identical to ALAE_DICC1: L-alanine exporter AlaE (alaE) from Dickeya chrysanthemi (strain Ech1591)

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_02449)

MetaCyc: 62% identical to AlaE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-469

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CU98 at UniProt or InterPro

Protein Sequence (153 amino acids)

>DZA65_RS19170 L-alanine exporter AlaE (Dickeya dianthicola ME23)
MLSPVSRLRGIVADTVAMVVYCFLTGMAIEILLSDMTFQQSLSSRLLSIPVNIVIAWPYG
LYRDRIVALALRLMRDLRWGKNMADLFAYVSFQSPVYAAILLTIGAEPSQILKAVASNAV
ISMFMGVAYGYFLEYCRRLFRVGVPVRPQIVSH