Protein Info for DZA65_RS19140 in Dickeya dianthicola ME23

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF01225: Mur_ligase" amino acids 24 to 72 (49 residues), 26.2 bits, see alignment 1.2e-09 TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase" amino acids 29 to 447 (419 residues), 466.6 bits, see alignment E=3.9e-144 PF08245: Mur_ligase_M" amino acids 106 to 293 (188 residues), 165.6 bits, see alignment E=2.1e-52 PF02875: Mur_ligase_C" amino acids 326 to 436 (111 residues), 51.5 bits, see alignment E=2.8e-17

Best Hits

Swiss-Prot: 70% identical to MURF_ECOLI: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (murF) from Escherichia coli (strain K12)

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 96% identity to ddd:Dda3937_02442)

MetaCyc: 70% identical to D-alanyl-D-alanine-adding enzyme (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase. [EC: 6.3.2.10]

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CI52 at UniProt or InterPro

Protein Sequence (453 amino acids)

>DZA65_RS19140 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Dickeya dianthicola ME23)
MIRVSLRQLADVLGARLVGEDLTISEVSTDTRKLTTGCLFVALRGEKFDAHDYAADAVNH
GAAALLVSKHLPIEVPQLVVDDTRLALGTMAGWVRQQSRARVVALTGSSGKTSVKEMTAA
ILRQCGNVLYTAGNFNNDIGVPLTLFRLAPEHDYAVIELGANHIGEIAYTTAMVRPEAAL
VNNLAAAHLEGFGSLDGVAQAKGEIFSGLPAQGVAIVNADSHDEARWHDALTGKTRWRFS
PQARAGVDFYASDVGISERGTDFVLHTPAGAVAVTLPLPGRHNIANALAAAALSLAVGAP
LDAVKTGLAQLQAVPGRLFPIALAPGKLLLDDSYNANVGSMTAAAQVLAEMPGYRVMVVG
DMAELGLGAQACHRQVGEAARKANIDKVLSVGTLSAFIGDVSGAGEHFDNKTALIDRLRT
LVTQHNTITVLIKGSRSAAMEQVVHALQENATC