Protein Info for DZA65_RS19010 in Dickeya dianthicola ME23

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 61 (18 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 398 to 420 (23 residues), see Phobius details amino acids 426 to 444 (19 residues), see Phobius details PF00324: AA_permease" amino acids 17 to 448 (432 residues), 424.2 bits, see alignment E=6.6e-131 PF13520: AA_permease_2" amino acids 21 to 438 (418 residues), 114.4 bits, see alignment E=6.6e-37

Best Hits

Swiss-Prot: 76% identical to AROP_ECOLI: Aromatic amino acid transport protein AroP (aroP) from Escherichia coli (strain K12)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 96% identity to ddc:Dd586_3510)

MetaCyc: 76% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMJ6 at UniProt or InterPro

Protein Sequence (448 amino acids)

>DZA65_RS19010 amino acid permease (Dickeya dianthicola ME23)
MQDQQDGTLQRGLKNRHIQLIALGGAVGTGLFLGIAQTIKMAGPSVLLGYAIGGLIAFFI
MRQLGEMVVEEPVAGSFSHFAYKYWGNFAGFASGWNYWVLYVLVAMAELSAVGIYVQYWW
PGIPTWVSAAVFFVLINAVNLANVKMYGELEFWFAIIKVVAIVGMIVFGGWLLLSGHGGP
DATITNLWAQGGFFPNGVAGLVMAMAVIMFSFGGLELVGITAAEADKPEESIPRATNQVI
YRILIFYIGSLTVLLSLYPWGKVVEGGSPFVMIFHALNSELVANILNIVVLTAALSVYNS
CVYCNSRMLYGLAKQGNGPQSLLKVDRRGVPVVAIGVSALATALCVLINYLLPGKAFELL
MALVVSALVINWAMISLAHLKFRASKERAGVQTRFKALWFPFGNYLCLAFMAGILVIMYL
TPGIQISVLLIPVWLVVLGIGYRFKKRQ