Protein Info for DZA65_RS18985 in Dickeya dianthicola ME23

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF12715: Abhydrolase_7" amino acids 63 to 342 (280 residues), 48.4 bits, see alignment E=2.3e-16 PF12697: Abhydrolase_6" amino acids 162 to 386 (225 residues), 31.7 bits, see alignment E=6.1e-11 PF01738: DLH" amino acids 175 to 375 (201 residues), 50.7 bits, see alignment E=4.7e-17

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_03095)

Predicted SEED Role

"FIG00613732: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C3L2 at UniProt or InterPro

Protein Sequence (396 amino acids)

>DZA65_RS18985 hydrolase (Dickeya dianthicola ME23)
MKRRGLRRTLCVLMCCLASAPLMANDHSYTTTSVTDDALPTFYPQLKQQLTYPDSWLSGR
YAHFGEWRQHARQLVRSLLLTPNSHRAFEPQVVDSQDRDTYVAQKVAFNLTDENRVPGLL
LTPKTPGPHPAVLLLHDHGAKFDIGKEKMIRPWGDDTRLASANAWADRYFTGRFVGDELA
KRGYVVLAVDALGWGDRGPLKYEQQQALASNFFNLGRSLAGNMAYEDMRSLDFLASLHSV
DPQRVGVVGFSMGAYRAWQLAALSDKTAATAAISWIGTYDGLMVPGNNVLRGQSSFYMLH
PGLPAHLDFPDVASIAAPRPMLFFNGGKDNLFPQQAVQAAYDRMHQVWRSQHADERLETR
IWPELGHVFYQEQQEAVFQWLDRWLASPDRAVSTAR