Protein Info for DZA65_RS18705 in Dickeya dianthicola ME23

Annotation: type I-F CRISPR-associated protein Csy1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR02564: CRISPR type I-F/YPEST-associated protein Csy1" amino acids 59 to 434 (376 residues), 501.7 bits, see alignment E=6.5e-155 PF09611: Cas_Csy1" amino acids 59 to 424 (366 residues), 473.4 bits, see alignment E=2.9e-146

Best Hits

Swiss-Prot: 72% identical to CSY1_PECAS: CRISPR-associated protein Csy1 (csy1) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 89% identity to ddc:Dd586_3444)

Predicted SEED Role

"CRISPR-associated protein, Csy1 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CF64 at UniProt or InterPro

Protein Sequence (445 amino acids)

>DZA65_RS18705 type I-F CRISPR-associated protein Csy1 (Dickeya dianthicola ME23)
MEERELTQFIVSYIGTRKQAKLDAFDKAADKQREALSGEALAAAELTLAQDRREIELAYE
VRGWLTDAASRAGQISLVTHALKFTHSDAKGSSVFSTELAGDNAVLSTASLAQPAIDAVG
NAAALDVAKLLQTEHHGDSLLAALQRGDHRALEALAENSEQLAQWLAGFRQVLSDKQPGS
HFLAKQIYFPVGEGQYHLLSPLYSSSLSQALDQRLNLARFGEQAKATREARRQKRWHDEV
DVSYPSIAVQNMGGTKPQNISALNSARSGRSYLLNSAPPQWRSQIKPPLDHDTLFRERGE
VDALTYADRRDMRQFLLSVKDVENNREIRNQRRRYLDQLIDTLFGYVASVQNLRPAGWSK
DSRLNTPLQLWLDPFRCRQDDAFRYAREGGDWKEQVAHEFGQWLNDRLQHEKLIFGEVER
REWSTAALFKQRLRETERALKEELA