Protein Info for DZA65_RS18525 in Dickeya dianthicola ME23

Annotation: PTS sugar transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02302: PTS_IIB" amino acids 3 to 99 (97 residues), 64.8 bits, see alignment E=4.6e-22

Best Hits

Swiss-Prot: 45% identical to PTEB_BACSU: PTS system oligo-beta-mannoside-specific EIIB component (gmuB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02760, PTS system, cellobiose-specific IIB component [EC: 2.7.1.69] (inferred from 100% identity to ddd:Dda3937_02582)

Predicted SEED Role

"PTS system, cellobiose-specific IIB component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1N4 at UniProt or InterPro

Protein Sequence (105 amino acids)

>DZA65_RS18525 PTS sugar transporter subunit IIB (Dickeya dianthicola ME23)
MKRIVLACSAGMSTSLVVTKMEKEATARGMEYQIYAIPEQNLRDELQTYGDDIIAVLLGP
QVRFKLTENKKLTDEYQIPIAVIDSVAYGTLNGAKVLDQALSLVN