Protein Info for DZA65_RS18405 in Dickeya dianthicola ME23

Annotation: ribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 TIGR02063: ribonuclease R" amino acids 19 to 722 (704 residues), 916.2 bits, see alignment E=1.4e-279 PF08461: WHD_RNase_R" amino acids 22 to 85 (64 residues), 65.3 bits, see alignment 9.8e-22 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 67 to 721 (655 residues), 887.2 bits, see alignment E=6.3e-271 PF08206: OB_RNB" amino acids 87 to 144 (58 residues), 74.9 bits, see alignment 7.9e-25 PF17876: CSD2" amino acids 164 to 238 (75 residues), 81.9 bits, see alignment E=7.1e-27 PF00773: RNB" amino acids 260 to 587 (328 residues), 357 bits, see alignment E=2.6e-110 PF00575: S1" amino acids 639 to 720 (82 residues), 51.2 bits, see alignment E=3.4e-17

Best Hits

Swiss-Prot: 76% identical to RNR_ECOLI: Ribonuclease R (rnr) from Escherichia coli (strain K12)

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 96% identity to ddd:Dda3937_02609)

MetaCyc: 76% identical to RNase R (Escherichia coli K-12 substr. MG1655)
3.1.13.-

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3H0 at UniProt or InterPro

Protein Sequence (825 amino acids)

>DZA65_RS18405 ribonuclease R (Dickeya dianthicola ME23)
MSQDPFLEREAEKYESPIPSREYILEHLAKRDTPISREELATDLQLTSDEQLEALRRRLR
AMERDGQLVFTRRQCYALPEKLDLLRGTVLGHRDGYGFLRVEGRKDDLYLSAEQMKTVIH
GDVVLAQPLGEDRRGRREGRIVRILEPRTNQIVGRYFTEAGTGFVVPDDSRLSFDILIPS
EFIAGARMGSVVVVELTQRATRRTKAIGKIVEILGDNMGTGLAVDIALRTHEIPHSWPPK
VEEQVSDLADEVPEDAKKGRIDLRSLPLVTIDGEDARDFDDAVYCEKKRGGGWRLWVAIA
DVSYYVRPGTALDHEARARGTSVYFPSQVVPMLPEVLSNGLCSLNPQVDRLCMVCEMTVS
TQGKLSGYTFYEAVMSSHARLTYTKVWSILQGDEALREHYQPLVAPLEELHQMYKVLDHA
REVRGGIAFETEEAKFIFNAERRIERVEAVVRNDAHKLIEECMILANISAAKFVEKNEEP
ALFRVHDQPSEDHVLALRSVLGELGLTLKGGMKPQPKDYAELMNSIAGRPDHEMLQTMLL
RSMKQAVYDPENRGHFGLALTSYGHFTSPIRRYPDLSLHRAIKYLLSDRKACWTHSGGWH
ADFNEMLQLGEHCSMTERRADEATRDVADWLKCDFMQDHVGEAFTGIISSVTGFGFFVRL
NDLFIDGLVHVSTLDNDYYRYDNVGQRLIGESRGQVYRLGDEVQIRVEAVHMDERKIDFA
LLSSTRKVRGEGKTARDRVKKGAASDAKPPRRRRTGQRANVEPDSAFRPDGDGKRQSAGK
GKDKAKAGGGKKTEKSQKNAEKTRKIAAATRAKRASKKKKPAEPA