Protein Info for DZA65_RS18310 in Dickeya dianthicola ME23

Annotation: HlyC/CorC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 56 to 76 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details PF01595: CNNM" amino acids 6 to 197 (192 residues), 147 bits, see alignment E=7.6e-47 PF00571: CBS" amino acids 283 to 333 (51 residues), 20.6 bits, see alignment 7e-08 PF03471: CorC_HlyC" amino acids 348 to 425 (78 residues), 74.9 bits, see alignment E=6.3e-25

Best Hits

Swiss-Prot: 80% identical to YTFL_ECOLI: UPF0053 inner membrane protein YtfL (ytfL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_00163)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D139 at UniProt or InterPro

Protein Sequence (438 amino acids)

>DZA65_RS18310 HlyC/CorC family transporter (Dickeya dianthicola ME23)
MLNSLLIILFLIAISAFFSLSEISLAASRKIKLKLMADEGDLNATLVLKFQETPGIFFTV
IQIGLNAVAILAGIIGDAAFSPYFEMLFARFLPQDMVVRASFICSFVLVTSLFILFGDLT
PKRIGMIAPETIAIRIINPMRFCLLVFRPLVWLFNGLANLIFRLFKLPMVRKEDITPDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRESVVYFDLHEDEAQIKEKIAH
QPHSKFLVCNGTIDQIVGYVDSKDLLNRVLGNQSLELTSGVQIRPALIVPDTLTLSEALE
SFKTAGEDFAVILNEYALIVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLIEGGTP
IEDVMRALSIDAFPHSDNYETIGGFMMYTLRKIPKRTDFVRYAGYKFEVVDIDSYKIDQL
LVTRLEERTTVNAETHPA