Protein Info for DZA65_RS18160 in Dickeya dianthicola ME23

Annotation: glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 TIGR00045: glycerate kinase" amino acids 2 to 375 (374 residues), 550.8 bits, see alignment E=7.6e-170 PF02595: Gly_kinase" amino acids 3 to 374 (372 residues), 528 bits, see alignment E=6.3e-163

Best Hits

Swiss-Prot: 69% identical to GLXK1_ECOLI: Glycerate 2-kinase (garK) from Escherichia coli (strain K12)

KEGG orthology group: K00865, glycerate kinase [EC: 2.7.1.31] (inferred from 96% identity to ddd:Dda3937_00192)

MetaCyc: 69% identical to glycerate 2-kinase 1 (Escherichia coli K-12 substr. MG1655)
GKI-RXN [EC: 2.7.1.165]

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.165 or 2.7.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1F8 at UniProt or InterPro

Protein Sequence (380 amino acids)

>DZA65_RS18160 glycerate kinase (Dickeya dianthicola ME23)
MKIVIAPDSYKESLSAQEVATQIEAGFREVFPNASYVKLPVADGGEGTVEAMVAATRGKI
VKVNVTGPLGDDTDAFFGLSGDEKTAFIEMAAASGLERVPPHLRNPLLTTSYGTGELIRC
ALDHGVRHCIIGIGGSATNDGGAGMVQALGAQLLDDAKQPIGFGGAELARLAHIDTRSLD
PRIRQCRFEVACDVTNPLTGKLGASAVFGPQKGATEAMVEQLDHALLHYADVIRRDLDID
VEQVPGAGAAGGMGAALLAFCGAELRRGIEIVTEALGLDELVRDASLVITGEGRIDSQTI
HGKVPIGVASVAKRYHKPVIGIAGSLTADVGVVHEHGLDAVFSVLYNICSLEEALDNAAD
NVRMTARNIAATIKLAQTIS