Protein Info for DZA65_RS18150 in Dickeya dianthicola ME23

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF01938: TRAM" amino acids 11 to 66 (56 residues), 45.9 bits, see alignment 1.1e-15 TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA" amino acids 24 to 430 (407 residues), 449.6 bits, see alignment E=5.6e-139 PF05958: tRNA_U5-meth_tr" amino acids 268 to 433 (166 residues), 75 bits, see alignment E=1.4e-24 PF01135: PCMT" amino acids 279 to 348 (70 residues), 24.8 bits, see alignment E=4.5e-09 PF13847: Methyltransf_31" amino acids 293 to 369 (77 residues), 42.3 bits, see alignment E=1.6e-14 PF13649: Methyltransf_25" amino acids 296 to 351 (56 residues), 32.1 bits, see alignment 3.9e-11

Best Hits

Swiss-Prot: 74% identical to RLMD_PECCP: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 95% identity to ddd:Dda3937_00194)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y171 at UniProt or InterPro

Protein Sequence (444 amino acids)

>DZA65_RS18150 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Dickeya dianthicola ME23)
MAQFYSPNRRVTTRQTLTVTANDLDPFGQGVARHQGKTLFIPGVLPGEQAEVQLTEEKRQ
FAHARLRRLLTTSEERVTPRCPHFSVCGGCQQQHASQPLQHRSKAAALTHLMTRETGAVP
PEPEVIAESAYAYRRRARLALYYQAKTHRLQMGYRQAGSHDLVDIAACPILCPELEALLA
PLRDCLGQLQAVRRLGHVELVLAEQGPLVVLRHLDPLRDADRQALTAFAVLHGTALFSAP
EAGALECLHGDMPSYRIAGLSLAFSPRDFIQVNDGINQRMVEQALTWLDPQPQDRVLDLF
CGMGNFTLPLAVRAGSVVGVEGVAALVDKGRENARRNGLTQVTFYHHDLEADVTLQPWAA
MGFDKILLDPARAGAPGVMPQIVKLAPRRVVYISCNPTTLARDSNVLMAAGYRLARLAML
DMFPHTGHLESMALFLLGSDGSVK