Protein Info for DZA65_RS18110 in Dickeya dianthicola ME23

Annotation: 7-carboxy-7-deazaguanine synthase QueE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR04322: putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE" amino acids 9 to 223 (215 residues), 363.1 bits, see alignment E=2.1e-113 PF13353: Fer4_12" amino acids 13 to 113 (101 residues), 23.5 bits, see alignment E=6e-09

Best Hits

Swiss-Prot: 76% identical to QUEE_SHIFL: 7-carboxy-7-deazaguanine synthase (queE) from Shigella flexneri

KEGG orthology group: K10026, queuosine biosynthesis protein QueE (inferred from 95% identity to ddd:Dda3937_00204)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1E8 at UniProt or InterPro

Protein Sequence (223 amino acids)

>DZA65_RS18110 7-carboxy-7-deazaguanine synthase QueE (Dickeya dianthicola ME23)
MLYPINEMFQTLQGEGFFTGVPAVFIRLQGCPVGCSWCDTKHTWEKRPERQISLAEVVVK
SGESDAWSGSSAEDLIQRMALQGYSARHVVITGGEPCLHDLIPLTQALEQQGFSTQIETS
GTHEVRCSPACWVTVSPKVNMRGGLAVLDQALQRADEIKHPVARERDIAALDALLARLDD
DKARVVALQPVSQKDDATRLCIETCIARNWRLSMQTHKYLNIA