Protein Info for DZA65_RS18065 in Dickeya dianthicola ME23

Annotation: sulfate adenylyltransferase subunit CysN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF00009: GTP_EFTU" amino acids 26 to 232 (207 residues), 153.8 bits, see alignment E=8.1e-49 TIGR02034: sulfate adenylyltransferase, large subunit" amino acids 28 to 434 (407 residues), 679.6 bits, see alignment E=1.6e-208 TIGR00231: small GTP-binding protein domain" amino acids 34 to 214 (181 residues), 52.9 bits, see alignment E=3.6e-18 PF03144: GTP_EFTU_D2" amino acids 265 to 324 (60 residues), 31.6 bits, see alignment E=3.7e-11 PF22594: GTP-eEF1A_C" amino acids 338 to 434 (97 residues), 74.1 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 83% identical to CYSN_YERE8: Sulfate adenylyltransferase subunit 1 (cysN) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K00956, sulfate adenylyltransferase subunit 1 [EC: 2.7.7.4] (inferred from 97% identity to ddd:Dda3937_03902)

MetaCyc: 80% identical to sulfate adenylyltransferase subunit 1 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D1E5 at UniProt or InterPro

Protein Sequence (475 amino acids)

>DZA65_RS18065 sulfate adenylyltransferase subunit CysN (Dickeya dianthicola ME23)
MNHSIAKQIADQGGVEAYLHAQQNKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLS
TLHNDSKRLGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQY
TRNMATGASTCELAILLIDARKGVLDQTRRHSFIATLLGIRHLVVAVNKMDLVGYQQVVF
DQFKQDYLDFAGQLPTDLNITFVPISALDGDNVATPSTTMSWYHGPTLLDVLETVNVSSR
SLSQPMRFPVQYVNRPNLDFRGYAGTVASGVVRVGQRVKVLPSGVESSVSRIVTFDGDLQ
QAQAGEAVTLVLSSDVDISRGDLLVGHEETLQSVRSAKVDVVWMAEQPLVPGQSYDIKIA
GKKTRARVENIDYQVEINTLTQRVTESLPLNGIGLVELTFDEPLVLDKYQQNPVTGGMIF
IDRLSNVTVGAGLVREPVALEEPKADRYGAFELELNALIRRHFPHWGARDLLGGK