Protein Info for DZA65_RS17890 in Dickeya dianthicola ME23

Annotation: AzlC family ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 182 to 208 (27 residues), see Phobius details PF03591: AzlC" amino acids 6 to 146 (141 residues), 139.3 bits, see alignment E=5.7e-45

Best Hits

Swiss-Prot: 74% identical to YGAZ_ECOLI: Inner membrane protein YgaZ (ygaZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_00896)

MetaCyc: 74% identical to L-valine exporter, YgaZ component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-269

Predicted SEED Role

"FIG00638108: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0W6 at UniProt or InterPro

Protein Sequence (226 amino acids)

>DZA65_RS17890 AzlC family ABC transporter permease (Dickeya dianthicola ME23)
MFDSLPIVIGYVPVAFAFGLNAVKLGFTPLEAIFLSCIIYAGASQFVITALLSAGASIWV
AALTVMAMDVRHVLYGPSLRRRIVQRLPTGKTAWWAFGLTDEVFAAATARLSRDNRRWSE
SWMLGVALSAWLSWVAGTVLGAVFGNGPLAGYPAVEAALAFMLPALFLSFLLASFRRRQS
LVVAAALGGAGLGLLVSSIPAAILIGIGGGCLASLYQPASIKEETR