Protein Info for DZA65_RS17880 in Dickeya dianthicola ME23

Annotation: glycine betaine/L-proline ABC transporter permease ProW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 142 to 163 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details amino acids 237 to 264 (28 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 208 to 374 (167 residues), 96.5 bits, see alignment E=8.7e-32

Best Hits

Swiss-Prot: 92% identical to OUSW_DICD3: Glycine betaine/choline transport system permease protein OusW (ousW) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 92% identity to ddd:Dda3937_00900)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DRI6 at UniProt or InterPro

Protein Sequence (402 amino acids)

>DZA65_RS17880 glycine betaine/L-proline ABC transporter permease ProW (Dickeya dianthicola ME23)
MTDATQNPWEETQTPDPITAANHSHAAASGEHAAAAAGSSGNPAQTDPWAPSSAPAGNAP
DNAADAWSNAPPPAANDVHQNESDWLNAPAPTQEHFDLMDPFRHTLVPLDHWVTEGIDWL
VLHFRPLFQGIRVPVDVILNSFQQLLTGLPAPVAILAFSLLAWQVSGFSMGAATLLSLVA
IGAIGAWTQAMVTLALVLTALFFCIIVGLPLGIWLAHSDRAARIVRPLLDAMQTTPAFVY
LVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGIRQVPADLVEAAQSFGASPRQMLFKV
QLPLAMPTIMAGINQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLASIGGAGIVI
LAIILDRLTQSLGRDARSRGNRHWYHHGPLGLLARPFIKSRV