Protein Info for DZA65_RS17865 in Dickeya dianthicola ME23

Annotation: NCS1 family nucleobase:cation symporter-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 376 to 400 (25 residues), see Phobius details amino acids 429 to 450 (22 residues), see Phobius details amino acids 456 to 472 (17 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 30 to 461 (432 residues), 283.6 bits, see alignment E=1.4e-88

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 95% identity to dze:Dd1591_0866)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CWT9 at UniProt or InterPro

Protein Sequence (494 amino acids)

>DZA65_RS17865 NCS1 family nucleobase:cation symporter-1 (Dickeya dianthicola ME23)
MPENMTPAGTPPAHYSPRLCNEDLAPTRVQSWSWYNIFSFWMSDVHSMGGYVVAASFFTL
GLASWQVLLCLLAGICIVQLCANLVAKPSQMSGVPYAVICRQSFGVFGANIPAVIRGLIA
FAWYGIQTYLAANALMLVLLKFVPSLTPLTASHWLGLSTLGWLCFGVMWLLQAMVFWHGM
SAIKRFIDIAGPAVYIVMLALAGWIVYKTGLGNISFTLSSKSLSNGEQAWQMITATALVV
SYFSGPLLNFGDFSRYGKSLQEIRRGNRWGLPFNFLLFSIVTVVIVSGTQSLFGQMITDP
IETVSRVGNSVAVALGLLTMIVATIGINIVANFVSPAFDFSNCSPQRISFRTGGMIAAVG
SVLLTPWNLFNSPELIHYTLDVLGAFIGPLFGILLADFYLIKGGKVDVDALFNDTPSGRY
WYRNGINPNAVLALLPSVAIGLVISFVPAWHEIANFSWFIGVALGAGSYRYLARREKAVM
PTATGMSGLVLGKE