Protein Info for DZA65_RS17845 in Dickeya dianthicola ME23

Annotation: oxalurate catabolism protein HpxZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 PF11533: AtzH-like" amino acids 4 to 125 (122 residues), 209.6 bits, see alignment E=1.6e-66 PF13474: SnoaL_3" amino acids 15 to 125 (111 residues), 24.9 bits, see alignment E=3.4e-09 PF14534: DUF4440" amino acids 16 to 117 (102 residues), 32.4 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_00908)

Predicted SEED Role

"FIG00441296: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CXF5 at UniProt or InterPro

Protein Sequence (126 amino acids)

>DZA65_RS17845 oxalurate catabolism protein HpxZ (Dickeya dianthicola ME23)
MTPEINLPDVLAEVTTAFYRYEKALTGNDIEVLDQLFWHDERTVRYGASENLYGIEQIRA
FRAARPSAGLDRQLQNTVITAYGRDMAVASTEFRREGSDNIGRQMQTWLRTEQGWRIVAA
HVSLMV