Protein Info for DZA65_RS17610 in Dickeya dianthicola ME23

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF02525: Flavodoxin_2" amino acids 1 to 169 (169 residues), 131 bits, see alignment E=2.3e-42

Best Hits

Swiss-Prot: 38% identical to GS14_BACSU: General stress protein 14 (ywrO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 63% identity to tau:Tola_1989)

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.-

Use Curated BLAST to search for 1.6.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y319 at UniProt or InterPro

Protein Sequence (174 amino acids)

>DZA65_RS17610 NAD(P)H-dependent oxidoreductase (Dickeya dianthicola ME23)
MKTLIIVSHPYKEQSKIINALQQTAEVQDNVEVRNLETLYGDTISGFDVSREQASYNGVD
RVVFIYPIHWFNLTPMLKAYLNEVWTYGWAFGPEGNALKDKECLVVTSAGASEHTYSHQG
LIQSTIGEVLTPMKATALYVGMKYLEPIAFHRVMEATREKIAEFQRVLSDRLKS