Protein Info for DZA65_RS17580 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details amino acids 35 to 35 (1 residues), see Phobius details transmembrane" amino acids 33 to 34 (2 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 273 (182 residues), 107.9 bits, see alignment E=2.7e-35

Best Hits

Swiss-Prot: 46% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 98% identity to ddc:Dd586_3213)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D772 at UniProt or InterPro

Protein Sequence (275 amino acids)

>DZA65_RS17580 ABC transporter permease (Dickeya dianthicola ME23)
MFDVLKKLLHTPQGVAGLGILLLALITVCAGVHLAPADPEAISILARYKAPSAMHWFGTD
QLGRDILSRVLVGARTTILYSLLATSLAMVAGSVIGTASAYLGGRMDEGIMRTMDAVMSI
PSLLFALLIVSTLGQSSLNAVLAITIAFVPGMVRIARSVALAARQQDYVNAAIARGESSG
YIILREMLPNIVAPIIVESTIRVSFAIMLFATLSFLGLGAQPPQPEWGLMVSEARAYFFN
APWMMLIPGLAIAIVAIGFNLLGDGLRDVLNPRSH