Protein Info for DZA65_RS17445 in Dickeya dianthicola ME23

Annotation: recombination regulator RecX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF02631: RecX_HTH2" amino acids 66 to 106 (41 residues), 46 bits, see alignment E=4.9e-16 PF21981: RecX_HTH3" amino acids 116 to 156 (41 residues), 44.7 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 59% identical to RECX_PECAS: Regulatory protein RecX (recX) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03565, regulatory protein (inferred from 92% identity to ddd:Dda3937_03153)

Predicted SEED Role

"Regulatory protein RecX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CY59 at UniProt or InterPro

Protein Sequence (162 amino acids)

>DZA65_RS17445 recombination regulator RecX (Dickeya dianthicola ME23)
MSKVLRYAMNVLAVRDHSETELRRKIAAYLQTKRECDNADECSALPDLNTQIEQAVTRCR
QQGWLDDARYALRYISSRCRKGYGTQRICAELSQRGIDKSTQRMALQSCDIDWYLQAKAV
ATRKFGSSLPVNWRERAKVQRYLLYRGFSHDEIQSVYMNFSD