Protein Info for DZA65_RS17405 in Dickeya dianthicola ME23

Annotation: DedA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 65 (25 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details PF09335: VTT_dom" amino acids 33 to 132 (100 residues), 35.4 bits, see alignment E=7e-13

Best Hits

Swiss-Prot: 52% identical to YQAA_ECOLI: Inner membrane protein YqaA (yqaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_03149)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMR0 at UniProt or InterPro

Protein Sequence (142 amino acids)

>DZA65_RS17405 DedA family protein (Dickeya dianthicola ME23)
MSEFWAVFSLFWSSFLSATLLPGSSEVVLVSLLLTHSTSSLLLIAIASIGNTLGGITNII
VGRLVPELKPQKGLDTARSWLQRYGTAALLLSWVPVVGDILCVLSGWLRMPWASSIICIF
IGKTLRYLIVAGVALKWTMGTG