Protein Info for DZA65_RS17385 in Dickeya dianthicola ME23

Annotation: signal recognition particle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR00959: signal recognition particle protein" amino acids 2 to 429 (428 residues), 594.2 bits, see alignment E=7.1e-183 PF02881: SRP54_N" amino acids 5 to 82 (78 residues), 79.7 bits, see alignment E=3.8e-26 PF06414: Zeta_toxin" amino acids 96 to 206 (111 residues), 27.2 bits, see alignment E=6.5e-10 PF00448: SRP54" amino acids 100 to 296 (197 residues), 254.2 bits, see alignment E=2e-79 PF01656: CbiA" amino acids 110 to 257 (148 residues), 26 bits, see alignment E=1.9e-09 PF02978: SRP_SPB" amino acids 310 to 445 (136 residues), 160.2 bits, see alignment E=8.2e-51

Best Hits

Swiss-Prot: 91% identical to SRP54_ECOLI: Signal recognition particle protein (ffh) from Escherichia coli (strain K12)

KEGG orthology group: K03106, signal recognition particle subunit SRP54 (inferred from 99% identity to ddd:Dda3937_03944)

Predicted SEED Role

"Signal recognition particle, subunit Ffh SRP54 (TC 3.A.5.1.1)" in subsystem Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0Y4 at UniProt or InterPro

Protein Sequence (453 amino acids)

>DZA65_RS17385 signal recognition particle protein (Dickeya dianthicola ME23)
MFENLTDRLSRTLRNISGRGRLTEDNIKDTLREVRMALLEADVALPVVRDFINRVKEQAV
GHDVNKSLTPGQEFVKIVQNELVAAMGEVNQALNLAAQPPAVVLMAGLQGAGKTTSVGKL
GKFLREKQKKKVLVVSADVYRPAAIKQLETLAQTVGVDFFPSEAHEKPIDIVNRALQHAK
LKFYDVLLVDTAGRLHVDDAMMDEIKQVHASINPVETLFVVDAMTGQDAANTAKAFNEAL
PLTGVILTKIDGDARGGAALSIRHITGKPIKFLGVGEKTDALEPFYPDRIASRILGMGDV
LSLIEELESKVDRTQAEKLAKKLKKGDGFDLTDFLDQLKQMRNMGGMASMMSKLPGMGQI
PDNMKSQMDDKVLVRMEAIINSMTLQERAKPEIIKGSRKRRIATGAGMQVQDVNRLLKQF
DDMQRMMKKMKNGGLAKMMRGMKGMMPPGFPGR