Protein Info for DZA65_RS17355 in Dickeya dianthicola ME23

Annotation: 3-deoxy-7-phosphoheptulonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR00034: 3-deoxy-7-phosphoheptulonate synthase" amino acids 9 to 350 (342 residues), 547.9 bits, see alignment E=3.7e-169 PF00793: DAHP_synth_1" amino acids 43 to 340 (298 residues), 328.4 bits, see alignment E=1.2e-102

Best Hits

Swiss-Prot: 79% identical to AROF_ECOLI: Phospho-2-dehydro-3-deoxyheptonate aldolase, Tyr-sensitive (aroF) from Escherichia coli (strain K12)

KEGG orthology group: K01626, 3-deoxy-7-phosphoheptulonate synthase [EC: 2.5.1.54] (inferred from 99% identity to ddd:Dda3937_01566)

MetaCyc: 79% identical to 3-deoxy-7-phosphoheptulonate synthase, Tyr-sensitive (Escherichia coli K-12 substr. MG1655)
3-deoxy-7-phosphoheptulonate synthase. [EC: 2.5.1.54]

Predicted SEED Role

"2-keto-3-deoxy-D-arabino-heptulosonate-7-phosphate synthase I alpha (EC 2.5.1.54)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.54

Use Curated BLAST to search for 2.5.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMS1 at UniProt or InterPro

Protein Sequence (354 amino acids)

>DZA65_RS17355 3-deoxy-7-phosphoheptulonate synthase (Dickeya dianthicola ME23)
MQKDTLNNINISAEQVLITPDELKAKFPLNEPEQQAIALSRKTIADIIHGSDKRLLVVCG
PCSIHDTDAALDYARRLQSLSAELSDRLYIVMRVYFEKPRTTVGWKGLINDPYMDGSFDM
EAGLHIARDLLLKLVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGL
SMPVGFKNGTDGSLGTAINAMKAASMPHRFVGINQSGQVCLLQTQGNPDGHVILRGGKKP
NYSAEDVAECEKQMRDAGLNPALMIDCSHGNSSKDYRRQPLVVESAIAQIKSGNRSIIGL
MLESHIHEGNQSSEQPRADMRYGVSVTDACISWESTETLLRSVHQELSARSANQ