Protein Info for DZA65_RS17340 in Dickeya dianthicola ME23

Annotation: ribosome-associated translation inhibitor RaiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 TIGR00741: ribosomal subunit interface protein" amino acids 1 to 98 (98 residues), 116.2 bits, see alignment E=4.1e-38 PF02482: Ribosomal_S30AE" amino acids 3 to 91 (89 residues), 82.3 bits, see alignment E=1.7e-27

Best Hits

Swiss-Prot: 80% identical to YFIA_ECOL6: Ribosome-associated factor Y (yfiA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05809, ribosome-associated inhibitor A (inferred from 98% identity to ddd:Dda3937_01570)

Predicted SEED Role

"Ribosome hibernation protein YfiA" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DUC9 at UniProt or InterPro

Protein Sequence (112 amino acids)

>DZA65_RS17340 ribosome-associated translation inhibitor RaiA (Dickeya dianthicola ME23)
MTINITSKQMDITPAIRQHVEDRLSKLDKWQTHLINPHIILSKEPQGFVVDATISTPNGP
LVASAKHEDMYTAVNELITKLERQLNKVQHKGEARRTDSCIKDVNLQASAEE