Protein Info for DZA65_RS17205 in Dickeya dianthicola ME23

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 70 (25 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 284 to 312 (29 residues), see Phobius details amino acids 322 to 350 (29 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 451 to 472 (22 residues), see Phobius details amino acids 508 to 528 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 66 to 252 (187 residues), 36.3 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 95% identity to ddd:Dda3937_04384)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CBT5 at UniProt or InterPro

Protein Sequence (535 amino acids)

>DZA65_RS17205 iron ABC transporter permease (Dickeya dianthicola ME23)
MTSGIWRISSVLLAGMLLFPLVTIVGMALSAPGDAVSALWHVLPVYGMNSLMLVAGCVLF
SLLFALPLAWLMSRYRFAGQVWLHRALLLPLAMPGYLLAAVYGDALGYEGPVKQTLYALS
FDMDIVPQTFWQQALMVACASLCLALVLFPYVYLIVRTALMSQPVSLQQAARLMNQTRAQ
AFWRVVFPMTRPAIALGMVLMASEALGDYGISAYFSLQTITTAGLDLWRDKAQHGTAALL
MSLLLPLVFLVWFQGRRSRARQLRYQKSSGVCPQSQPVLRGWPLFLTILFGGALVVIAFV
VPVGRLVCWAILSEAPTWSLPFLLAFTSSFVAATCATLLVIGLAVVCMFDFRAIGNPAYR
NPLRWLNLNRLLPSTALGMGLLVPFLGGDAWRAAAGGVVDDPWAGSVLVLILAYCMRFSG
LLIDRLQIRMSRLSGAMTHVSQSLGYTPALQVLWVYLPQLSHCLIVGVLLVFTESLRELN
ASLLLQPFEVETMATYVFRFMMDERLPLVASPALMLVGVGMIPLFGITRLMRMEG